Wikia

Brickipedia

Legends of Chima

Talk22
27,740pages on
this wiki
Rating-3-glossy
Legends of Chima
Lego-Logo-chima
Years:

2013-present

Subthemes:

Speedorz

Related themes:

Ninjago
Hero Factory
Fabuland


Legends of Chima is a theme introduced in 2013. The theme features the world of anthropomorphic creatures, called the Land of Chima, which is populated by at least 18 tribes and the war which threatens it. This theme was originally going to replace Ninjago, but in the end, both of the themes were kept and still in production.

Nine regular sets were featured in the first wave, in addition to six Speedorz" sets with more gradually being released throughout the year.

Speedorz is a game introduced with the theme which includes one-wheeled bikes, called Speedorz, powered by a rip-cord. The game involves completing challenges and surpassing obstacles to earn Chi crystals, the mineral the animals are fighting over in the TV series' storyline.

On January 16, 2013 Legends of Chima: The Animated Series premiered with two pilot episodes.[1] The cartoon continued again half-way through 2013, when the second wave of sets were released. A Second Season was released along with 2014's first wave of sets and a Third Season is scheduled for August 9, 2014 to coincide with the second wave.

Three video games for the theme have currently been released. The first, Legends of Chima: Speedorz, was released on iOS devices on January 1, 2013 and shortly after as an online game. The second is for the Nintendo 3DS and PlayStation Vita, called LEGO Legends of Chima: Laval's Journey. The last, an online game released in Fall 2013, was a massive multi-player online game called LEGO Legends of Chima Online.

Description

UpdatePlease This article is in need of an update. Once the information has been added from all of the sources listed below, this template may be removed.

Content that needs to be updated:

New Tribe Vehicles

One defining trait of the Legends of Chima theme is the animal-motif used by nearly every set in the line. Vehicles and structures will feature the head-shape, outline, or both, of their respective tribe's patron animal. Several vehicles also include blue tubing and/or lights to represent Chi powering it and/or a weapon. To date, six different factions have been released through several sets. Each faction has its own colourscheme and unique characteristics.

70005wholeset

70005 Laval's Royal Fighter

Vehicles and structures used by the lion tribe use flame yellowish orange as a primary color, brown for their manes, and different shades of lighter brown for accents and differentiation. White teeth, fangs, and claws are also a recurring attribute. The larger lion vehicles also feature red tongues inside jaws which can open and close. When the lion figureheads are given colored eyes, blue is generally chosen.

Le chimacrawleysreptiliengreifera

70001 Crawley's Claw Ripper

Olive green is the color chosen as the dominant one in the Crocodile Tribe's scheme while red is used secondarily for highlights. Different shades of green, such as bright yellowish, dark, and earth are used sparsely. Like the lions, the croc vehicles generally have claws and teeth, though in at least one set the claws are black and not white.

70003

70003 Eris' Eagle Interceptor

The eagle tribe's vehicles generally feature white bird-heads with yellow beaks. The body behind will generally be different shades of blue, including earth, bright, and dark azur, though white also appears for accents. Talons are a common feature, either coloured gold or black. Like the lions, the eagles' Chi weapons are mostly blue. Eagle architecture, which does not always include characteristics of real word eagles, generally feature stone structures with arches and smoothed, sloping tops, so long as a minifigure is not meant to be placed on it.

70004

70004 Wakz' Pack Tracker

The sole wolf vehicle released so far features a full wolf-head build into a truck colored medium and dark stone grey with dark red highlights. Aside from in the head's jaw, white teeth and fangs can be found around the vehicle at various locations. No Chi powered weapons appear, but according to the storyline it is rare that the wolves do use Chi weapons, and when they do, they consider it high-tech. Other notable features of the vehicle are the large wheels and flaming exhaust.

Le chimarazcalsrabengleitera

70000 Razcal's Glider

Two of the three raven vehicles are gliders with feather-like wings, Raven beaks, and Chi powered weapons represented with transparent red, as with the Crocodiles. Black is used as a primary color, dark grey for differentiation and a sheet-metal look, and dark red, medium lilac, and earth green are used for highlights, the latter for very subtle ones on one occasion.

Spin prod 902636812

70137 Bat Strike

70137 Bat Strike, an example of a Speedorz set Speedorz sets include a motorbike-like vehicle with one, blue wheel. A fairing, mould depending on the tribe which will feature attributes both printed and moulded such as beaks, teeth, and eyes, is placed on the chassis and a minifigure will sit inbetween. On the back, add-ons called power upz can be placed to extend the width or length. Power upz include claws, rotors, and flaming exhaust pipes.

Sets featuring speedorz will often include one or more obstacles and a ramp, in addition to cards, minifigure(s), accessories, and Chi crystals. The challenge will generally consist of an obstacle which needs to be cleared or targets which need to be disturbed in some way or another.

71Z3HaofbxL. SL1476

70208 CHI Panthar

Another component of the theme are constraction (constructable action) figures. There are currently 13, one of each of 2013's tribes, and one from each of the 2014's Ice Tribe, plus a new CHI Laval and CHI Cragger, along with two other fire constraction figures. They include a set consisting wholly of the figure featuring an exclusive moulded head and weapons. They are built using a system first introduced in 2011 with Hero Factory's Ordeal of Fire story-arc.


Background

Main Articles: List of Legends of Chima: The Animated Series episodes, Land of Chima

Of thousands of years of peace, Chima is once again torn in conflict because a misunderstanding, and the Crocodile Tribe leads it's allies into battle against the Lions.. Soon, Laval the Lion Prince is tricked into throwing the Crocodile's CHI into the "Gorge of Eternal Depth" and more tension comes.. Finally after months of fighting the tribes must unite because of a "Black Cloud" threatening Mt. Cavora, the source of CHI, yet when the CHI Falls stop, the Lions are blamed and the final battle for Chima has come! Though, when Laval and Cragger's showdown comes they find themselves falling to their deaths, until Laval sacrifices his life, reminding Cragger of his friendship with him. By faking his death Laval finds the Crocodile Legend Beast one of the eight Legend Beasts which can restart the falls, and returns much to Cragger's relief! Soon after the Tribes unite as allies to go and save the other Legend Beasts who are trapped in the Outlands. There they find shelter in Lavertus (the exiled Lion's) base and are able to free seven, until it is revealed that the CHI Laval threw was what created this new enemy that had trapped the Legend Beasts, the final Beast is saved and the Heroes barely escape, if not for Lavertus who uses his Golden CHI to support the exit and sacrifices his life. Finally the Falls are restarted and Chima is flourishing, that is until Scorm the Scorpion King accidentally awakens Sir Fangar an accent enemy, that was frozen for a millennia.. With plenty of CHI the Tribes are joyful, except for Laval's friend Eris who has dreams about a Phoenix Tribe who are masters of Fire.. While at home, Cragger finds his swamp under attack by the reawakened Ice Tribes, and hardly escapes with his Sister (who had secretly been the real reason for war in Chima in the first place). The Tribes try to fight back, but find themselves defenseless against the forces of Ice, until Eris convinces Laval and Cragger to go inside Mt. Cavora, because of her dream, much to their unbelief they meet Fluminox and discover the Phoenix, who have Fire CHI, the secret to the Ice Tribes' defeat, now the battle is on and the fate of an eternal Ice Age is in the 8 Heroes' hands..

Official Description

LEGO.com-icon-yellow This is a description taken from LEGO.com. Do not modify it.

The LEGO Group has announced LEGO® Legends of Chima™, an original LEGO property set in a mythical land of magical animal tribes who compete for CHI, a valuable energy source which gives them extraordinary powers over one another. The story comes to life through a universe of products across the company’s entire play system including classic building sets, collectible social competition kits, buildable figures and board games, and will be fueled by digital gaming.

“Building upon our success with developing rich and immersive original storylines, most notable the recent Ninjago phenomenon, we’re excited to launch a whole new world in LEGO Legends of Chima to spark any child’s imagination and invite them to the world of LEGO building,” said Søren Torp Laursen, president of LEGO Systems, Inc. “Based on the reactions we saw through our research, there is no doubt that our immersive approach to original properties will once again inspire, engage and thrill children who love to build and play with great stories.”

Story Chima is a magical land that is ruled by tribes of highly-advanced animals who walk, talk, drive vehicles and live in castles and forts. Two of the characters were best friends, but misunderstandings challenged their friendship and they now compete for CHI, a valuable natural resource that is a powerful element and source of life. Only a few brave heroes in Chima understand the true nature of CHI and their stories, and the stories of those who seek to destroy them, are known as The Legends of Chima.

Building Sets Seven richly detailed building sets inspired by the property are available now and range in price from $14.99 to $79.99. In August, the company will introduce six constructible LEGO Chima action figures for $14.99 each and four additional building sets, ranging in price from $24.99 to $119.99.

Speedorz™: Social Competitive Play Children can challenge friends, earn CHI and increase strength and power as they go from one obstacle to the next with the new line of Chima Speedorz. Build the Chima Speedorz and various obstacle courses, then pull the new ripcord to launch them. Players earn CHI crystals from their opponents by using the enclosed game cards. Six collectible Speedorz construction sets are available now, with more slated to launch in March, June and September. Each includes a new LEGO flywheel base with ripcord, minifigure, CHI crystals, assorted LEGO pieces and a set of trump cards at a suggested price of $14.99.

Gaming To extend the story and action play to fun for the whole family, a LEGO Chima constructible board game will be available in August for $19.99.

In a related announcement, Warner Bros. Interactive Entertainment today announced three LEGO Legends of Chima videogame titles. Available now on LEGO.com and iOS devices is LEGO Legends of Chima™: Speedorz™,, a free-to-play racing minigame. A LEGO Legends of Chima™: Laval’s Journey will be available for the Nintendo DS™ hand-held system, the Nintendo 3DS™ hand-held system and for the PS®Vita system this summer. Additionally, LEGO Legends of Chima™ Online, a free-to-play, online immersive world game, is scheduled to launch later in the year.


Products

Main article: List of Legends of Chima Sets

Characters

Lion Tribe


Eagle Tribe


Gorilla Tribe


Crocodile Tribe

135724 F L
LOCCrominus
Crawley
Crug
Crooler-1
Screen Shot 2014-10-02 at 12.14.44 PM
Screen Shot 2014-10-02 at 12.14.50 PM
Crocodile2015
CraggerCrominusCrawleyCrugCroolerTBA CrocodileTBA CrocodileTBA Crocodile


Raven Tribe


Wolf Tribe


Bat Tribe


Spider Tribe


Scorpion Tribe


Rhino Tribe


Nomads


Vulture Tribe


Saber-Tooth Tiger Tribe

70143 alt5
135713 E L
StealthorPic
Screen Shot 2014-07-19 at 4.06.19 PM
Sibress2015
Screen Shot 2014-10-02 at 12.15.13 PM
Screen Shot 2014-10-02 at 12.15.17 PM
Saber2015
Sir FangarStrainorStealthorSykorSibressUnnamed Sabre-Tooth TigerTBA Saber-Tooth TigerTBA Saber-Tooth Tiger


Tiger Tribe


Mammoth Tribe


Phoenix Tribe


Leopard Tribe


Ice Bear Tribe

Icebite2015
Icelaw2015
Screen Shot 2014-10-02 at 12.15.43 PM
Screen Shot 2014-10-02 at 12.15.47 PM
IceBear2015
IcebiteIcelawTBA Ice BearTBA Ice BearTBA Ice Bear


Bear Tribe


Beaver Tribe


Other Legends of Chima Media

Video Games

Online Games

IOS Games

Android Games

Television

Notes

  • Li'ella, Tormak, Lundor and Logas are all of different tribes, but fight for one order, The Cat Guides.
  • Instead of a regular plain Trans-Blue CHI element, the Summer 2014 sets have a Trans-Orange CHI element with Flame printing on it.
  • The Phoenix Tribe are the only animals to be based off of a mythical creature and not a real animal. The introduction of the Phoenix may go more into that CHI came from Chinese mythology and the phoenix are also in Chinese mythology.
  • This theme is similar to Fabuland in the case that both sets feature anthropomorphic animals.

Gallery

Character Teaser Videos

References

Sources

view · talk · edit Legends of Chima sets
Regular Sets (2013): 70000 Razcal's Glider | 70001 Crawley's Claw Ripper | 70002 Lennox' Lion Attack | 70003 Eris' Eagle Interceptor | 70004 Wakz' Pack Tracker | 70005 Laval's Royal Fighter | 70006 Cragger's Command Ship | 70007 Eglor's Twin Bike | 70008 Gorzan's Gorilla Striker | 70009 Worriz's Combat Lair | 70010 The Lion CHI Temple | 70012 Razar's CHI Raider | 70013 Equila's Ultra Striker | 70014 The Croc Swamp Hideout
Regular Sets (2014): 70128 Braptor's Wing Striker | 70129 Lavertus' Twin Blade | 70130 Sparratus' Spider Stalker | 70131 Rogon's Rock Flinger | 70132 Scorm's Scorpion Stinger | 70133 Spinlyn's Cavern | 70134 Lavertus' Outland Base | 70135 Cragger's Fire Striker | 70141 Vardy's Ice Vulture Glider | 70142 Eris Fire Eagle Flyer | 70143 Sir Fangar's Saber-Tooth Walker | 70144 Laval Fire Lion | 70145 Maula's Ice Mammoth Stomper | 70146 Flying Phoenix Fire Temple | 70147 Sir Fangar's Ice Fortress
Regular Sets (2015): 70220 Strainor's Saber Cycle | 70221 Flinx's Ultimate Phoenix | 70222 Tormak's Shadow Blazer | 70223 Icebite's Claw Driller | 70224 Tiger's Mobile Command | 70225 Cragger's Croc-Copter | 70226 Mammoth Ice Base | 70227 Bladvic's Bear Mech | 70229 Lion Tribe Pack | 70230 Ice Bear Tribe Pack | 70231 Crocodile Tribe Pack | 70232 Saber-Tooth Tiger Tribe Pack | 70233 Mammoth Tribe Pack
Speedorz: 70011 Eagles' Castle | 70100 Ring of Fire | 70101 Target Practice | 70102 CHI Waterfall | 70103 Boulder Bowling | 70104 Jungle Gates | 70105 Nest Jump | 70106 Ice Tower | 70107 Skunk Attack | 70108 Royal Roost | 70109 Whirling Vines | 70110 Tower Target | 70111 Swamp Jump | 70112 Croc Chomp | 70113 CHI Battles | 70114 Sky Joust | 70115 Ultimate Speedor Tournament | 70136 Banana Bash | 70137 Bat Strike | 70138 Web Dash | 70139 Sky Launch | 70140 Stinger Duel | 70149 Scorching Blades | 70150 Flaming Claws | 70151 Frozen Spikes | 70152 Lava Breakout | 70153 Fang Trap | 70154 Frozen Fortress | 70155 Inferno Pit | 70156 Fire vs. Ice
Constraction Figures: 70200 CHI Laval | 70201 CHI Eris | 70202 CHI Gorzan | 70203 CHI Cragger | 70204 CHI Worriz | 70205 CHI Razar | 70206 CHI Laval | 70207 CHI Cragger | 70208 CHI Panthar | 70209 CHI Mungus | 70210 CHI Vardy | 70211 CHI Fluminox | 70212 CHI Sir Fangar
Legend Beasts: 70123 Lion Legend Beast | 70124 Eagle Legend Beast | 70125 Gorilla Legend Beast | 70126 Crocodile Legend Beast | 70127 Wolf Legend Beast
LEGO Games: 50006 Legends of Chima
Promotional: 30250 Ewar's Acro-Fighter | 30251 Winzar's Pack Patrol |
Video Games: LEGO Legends of Chima: Laval’s Journey | LEGO Legends of Chima Online | Legends of Chima: Speedorz
Other: LEGO Legends of Chima: The Secret History | Chima Speedorz Challenge Promotional Set | 66450 Super Pack 3-in-1 | 850611 Cragger's Shield | 850612 Cragger Sword | 850614 Laval's Shield | 850615 Laval Sword | 6031640 Chima Promotional Pack | 6031641 Lion tribe rip-cord and topper | Lions and Eagles Activity Book | TBA Legends of Chima Brickmaster | Attack of the Crocodiles
view · talk · edit Legends of Chima Minifigures
Lion Tribe: Laval | Lennox | Leonidas | Longtooth | Lagravis | Lothar | Lavertus | ShadoWind | Lion Soldiers | Lion Elders | Li'ella
Eagle Tribe: Eglor | Equila | Eris | Ewar | Ewald | Elida | Ehboni | Reegull | Eagle Soldiers | Elkar
Gorilla Tribe: Gorzan | Grizzam | G'Loona | Grumlo | Gelsi | Gompsy | Gunter | Gorilla Soldiers
Raven Tribe: Razar | Rawzom | Razcal | Rizzo | Reabait | Reegull | Ripnik
Wolf Tribe: Wakz | Wilhurt | Winzar | Worriz | Windra | Wonald | Wrothgar | Wince Wolf Soldiers
Crocodile Tribe: Cragger | Crawley | Crug | Crominus | Crooler | Cruz | Crunket | Cranvil | Crumb | Crocodile Soldiers
Rhino Tribe: Rhigor | Rogon | Rinona | Rukus | Runk | Rheekon
Bear Tribe: Balkar | Bladvic | Bulkar | Bumpy | Bungey | Bozy | Buchuma
Beaver Tribe: Bezar | Buber | Bunic | Breezor | Beavers
Bat Tribe: Blista | Braptor | Banter | Bat Soldiers | Blink
Scorpion Tribe: Scolder | Scutter | Scorm | Scrug | Sparrmax | Scyther | Scorpion Soldiers
Spider Tribe: Sparacon | Sparratus | Spinlyn | Spindle | Spider Soldiers
Ice Bear Tribe: Icebite | Icepaw
Saber-Tooth Tiger Tribe: Sir Fangar | Strainor | Stealthor | Sykor | Sibress | Saber-Tooth Tiger Soldiers
Mammoth Tribe: Maula | Mungus | Mottrot | Mammoth Soldiers
Vulture Tribe: Vardy | VoomVoom | Vornon | Vulture Soldiers
Phoenix Tribe: Fluminox | Flinx | Foltrax | Frax | Firox
Leopard Tribe: Lundor
Tiger Tribe: Tormak/Panthar | Tazar | Trakkar | Tiger Soldier
Nomads: Dom de la Woosh | Furty | Skinnet
Legend Beasts: Bear Legend Beast | Crocodile Legend | Eagle Legend Beast | Gorilla Legend Beast | Lion Legend Beast | Raven Legend Beast | Rhinoceros Legend Beast | Wolf Legend

Start a Discussion Discussions about Legends of Chima

  • Chima ep. 40

    9 messages
    • No, the last diffused by Cartoon Network is the episode 39. So no episode 40 before 2015
    • It is called wings of fire airing on saturday and straight after is the heart of cavora!
  • Rogon Fire

    31 messages
    • Azerty588 wrote: ToaMatau2004 wrote: This thread is old. He told me he lied on his wiki a while back. Yeah but he come-back just for saying...
    • Yes and christmas is so close, too late for a reveal. Even for 2015, we have no picture of speedorz, I think lego canceled this kind of set.
Facts about Legends of ChimaRDF feed
ArticleRating3
Img18861662543902.jpg, Ewald.jpg, Screen_Shot_2014-10-02_at_12.18.45_PM.png, 135724_F_L.jpg, Razar2015.png, Worriz2015.png, Blista.png, Loc053.jpg, ScormSet.png, Loc059.jpg, LOCFurty.jpg, 70141_alt5.png, 70143_alt5.png, Tormak-Panthar.png, 8862945673246.jpg, 70146---1-500x500.jpg, 5702015124010_D.jpeg, Icebite2015.png, Balkar2015.png and Breezor2015.png
Img10Screen_Shot_2014-10-02_at_12.14.12_PM.png
Img2Leonidas.jpg, Equila C.png, 41CgwC7KV0L._SY300_.jpg, LOCCrominus.jpg, Rawzom.jpg, Winzar.jpg, Loc054.jpg, Loc061.jpg, 81QZvEgV1hL._SL1500_.jpg, Loc060.jpg, Chima-10.png, 70146_alt9.png, 135713_E_L.jpg, Tazar2015.png, 5702015124041_D.jpeg, Flinx2015.png and Icelaw2015.png
Img3Lennox-1.jpg, Eris2015.png, 81z23ixMjqL._SL1500_.jpg, Crawley.jpg, LOCRizzo.jpg, Wilhurt.jpg, LOCSpinlyn.jpg, 71Cqg0EqmqL._SL1500_.jpg, 70145_alt8.png, StealthorPic.jpeg, Trakkar.png, 8862947573790.jpg, 70146---3-500x500.jpg and Screen_Shot_2014-10-02_at_12.15.43_PM.png
Img4LOCLongtooth.jpg, Eglor.jpg, 51z1kJcua2L._SY300_.jpg, Crug.jpg, Razcal.png, Wakz1.jpg, Screen_Shot_2014-07-19_at_4.06.19_PM.png, Frax.jpg and Screen_Shot_2014-10-02_at_12.15.47_PM.png
Img570144_alt5.png, 30250 alt3.jpg, Crooler-1.jpg, Windra.jpeg, Sibress2015.png, Firox LoC.jpg and IceBear2015.png
Img6Loc055.jpg, Screen_Shot_2014-10-02_at_12.14.44_PM.png and Screen_Shot_2014-10-02_at_12.15.13_PM.png
Img7ShadowindSet.png, Screen_Shot_2014-10-02_at_12.14.50_PM.png and Screen_Shot_2014-10-02_at_12.15.17_PM.png
Img8Lioness2015.png, Crocodile2015.png and Saber2015.png
Img9Screen_Shot_2014-10-02_at_12.14.07_PM.png
InfoboxTemplateTheme +
TitleLegends of Chima
Txt1Lagravis, Ewald, Gorzan, Cragger, Razar, Worriz, Blista, Sparratus, Scorm, Rogon, Furty, Vardy, Sir Fangar, Tormak, Mottrot, Fluminox, Lundor, Icebite, Bulkar and Breezor
Txt10TBA Lioness
Txt2Leonidas, Equila, Grizzam, Crominus, Rawzom, Winzar, Braptor, Sparacon, Scutter, Rinona, Skinnet, VoomVoom, Strainor, Tazar, Mungus, Flinx, Icelaw and Bladvic
Txt3Lennox, Eris, G'Loona, Crawley, Rizzo, Wilhurt, Spinlyn, Scolder, Vornon, Stealthor, Trakkar, Maula, Foltrax and TBA Ice Bear
Txt4Longtooth, Eglor, Grumlo, Crug, Razcal, Wakz, Sykor, Frax and TBA Ice Bear
Txt5Laval, Ewar, Crooler, Windra, Sibress, Firox and TBA Ice Bear
Txt6Lavertus, TBA Crocodile and Unnamed Sabre-Tooth Tiger
Txt7ShadoWind, TBA Crocodile and TBA Saber-Tooth Tiger
Txt8Li'ella, TBA Crocodile and TBA Saber-Tooth Tiger
Txt9TBA Lion

Around Wikia's network

Random Wiki