

Legends of Chima

27,202pages on
this wiki
Legends of Chima




Related themes:

Hero Factory

Legends of Chima is a theme introduced in 2013. The theme features the world of anthropomorphic creatures, called the Land of Chima, which is populated by at least 18 tribes (the original tribes, the Dark Tribes and the Frozen Tribes) and the war which threatens it. This theme was originally going to replace Ninjago, but in the end, both of the themes were kept and still in production.

Nine regular sets were featured in the first wave, in addition to six Speedorz" sets with more gradually being released throughout the year.

Speedorz is a game introduced with the theme which includes one-wheeled bikes, called Speedorz, powered by a rip-cord. The game involves completing challenges and surpassing obstacles to earn Chi crystals, the mineral the animals are fighting over in the TV series' storyline.

On January 16, 2013 Legends of Chima: The Animated Series premiered with two pilot episodes.[1] The cartoon continued again half-way through 2013, when the second wave of sets were released. A Second Season was released along with 2014's first wave of sets and a Third Season is scheduled for August 9, 2014 to coincide with the second wave.

Three video games for the theme are currently known. One, known as Legends of Chima: Speedorz, was released on iOS devices on January 1, 2013 and shortly after as an online game. A second one is for the Nintendo 3DS and PlayStation Vita, and is called LEGO Legends of Chima: Laval's Journey. The last one, an online game, that was released Fall 2013 was a massive multi-player online game called LEGO Legends of Chima Online.


UpdatePlease This article is in need of an update. Once the information has been added from all of the sources listed below, this template may be removed.

Content that needs to be updated:

New Tribe Vehicles

One defining trait of the Legends of Chima theme is the animal-motif used by nearly every set in the line. Vehicles and structures will feature the head-shape, outline, or both, of their respective tribe's patron animal. Several vehicles also include blue tubing and/or lights to represent Chi powering it and/or a weapon. To date, six different factions have been released through several sets. Each faction has its own colourscheme and unique characteristics.


70005 Laval's Royal Fighter

Vehicles and structures used by the lion tribe use flame yellowish orange as a primary color, brown for their manes, and different shades of lighter brown for accents and differentiation. White teeth, fangs, and claws are also a recurring attribute. The larger lion vehicles also feature red tongues inside jaws which can open and close. When the lion figureheads are given colored eyes, blue is generally chosen.

Le chimacrawleysreptiliengreifera

70001 Crawley's Claw Ripper

Olive green is the color chosen as the dominant one in the Crocodile Tribe's scheme while red is used secondarily for highlights. Different shades of green, such as bright yellowish, dark, and earth are used sparsely. Like the lions, the croc vehicles generally have claws and teeth, though in at least one set the claws are black and not white.


70003 Eris' Eagle Interceptor

The eagle tribe's vehicles generally feature white bird-heads with yellow beaks. The body behind will generally be different shades of blue, including earth, bright, and dark azur, though white also appears for accents. Talons are a common feature, either coloured gold or black. Like the lions, the eagles' Chi weapons are mostly blue. Eagle architecture, which does not always include characteristics of real word eagles, generally feature stone structures with arches and smoothed, sloping tops, so long as a minifigure is not meant to be placed on it.


70004 Wakz' Pack Tracker

The sole wolf vehicle released so far features a full wolf-head build into a truck colored medium and dark stone grey with dark red highlights. Aside from in the head's jaw, white teeth and fangs can be found around the vehicle at various locations. No Chi powered weapons appear, but according to the storyline it is rare that the wolves do use Chi weapons, and when they do, they consider it high-tech. Other notable features of the vehicle are the large wheels and flaming exhaust.

Le chimarazcalsrabengleitera

70000 Razcal's Glider

Two of the three raven vehicles are gliders with feather-like wings, Raven beaks, and Chi powered weapons represented with transparent red, as with the Crocodiles. Black is used as a primary color, dark grey for differentiation and a sheet-metal look, and dark red, medium lilac, and earth green are used for highlights, the latter for very subtle ones on one occasion.

Spin prod 902636812

70137 Bat Strike

70137 Bat Strike, an example of a Speedorz set Speedorz sets include a motorbike-like vehicle with one, blue wheel. A fairing, mould depending on the tribe which will feature attributes both printed and moulded such as beaks, teeth, and eyes, is placed on the chassis and a minifigure will sit inbetween. On the back, add-ons called power upz can be placed to extend the width or length. Power upz include claws, rotors, and flaming exhaust pipes.

Sets featuring speedorz will often include one or more obstacles and a ramp, in addition to cards, minifigure(s), accessories, and Chi crystals. The challenge will generally consist of an obstacle which needs to be cleared or targets which need to be disturbed in some way or another.

71Z3HaofbxL. SL1476

70208 CHI Panthar

Another component of the theme are constraction (constructable action) figures. There are currently 13, one of each of 2013's tribes, and one from each of the 2014's Ice Tribe, plus a new CHI Laval and CHI Cragger, along with two other fire constraction figures. They include a set consisting wholly of the figure featuring an exclusive moulded head and weapons. They are built using a system first introduced in 2011 with Hero Factory's Ordeal of Fire story-arc.


Main Articles: List of Legends of Chima: The Animated Series episodes, Land of Chima

Of thousands of years of peace, Chima is once again torn in conflict because a misunderstanding, and the Crocodile Tribe leads it's allies into battle against the Lions.. Soon, Laval the Lion Prince is tricked into throwing the Crocodile's CHI into the "Gorge of Eternal Depth" and more tension comes.. Finally after months of fighting the tribes must unite because of a "Black Cloud" threatening Mt. Cavora, the source of CHI, yet when the CHI Falls stop, the Lions are blamed and the final battle for Chima has come! Though, when Laval and Cragger's showdown comes they find themselves falling to their deaths, until Laval sacrifices his life, reminding Cragger of his friendship with him. By faking his death Laval finds the Crocodile Legend Beast one of the eight Legend Beasts which can restart the falls, and returns much to Cragger's relief! Soon after the Tribes unite as allies to go and save the other Legend Beasts who are trapped in the Outlands. There they find shelter in Lavertus (the exiled Lion's) base and are able to free seven, until it is revealed that the CHI Laval threw was what created this new enemy that had trapped the Legend Beasts, the final Beast is saved and the Heroes barely escape, if not for Lavertus who uses his Golden CHI to support the exit and sacrifices his life. Finally the Falls are restarted and Chima is flourishing, that is until Scorm the Scorpion King accidentally awakens Sir Fangar an accent enemy, that was frozen for a millennia.. With plenty of CHI the Tribes are joyful, except for Laval's friend Eris who has dreams about a Phoenix Tribe who are masters of Fire.. While at home, Cragger finds his swamp under attack by the reawakened Ice Tribes, and hardly escapes with his Sister (who had secretly been the real reason for war in Chima in the first place). The Tribes try to fight back, but find themselves defenseless against the forces of Ice, until Eris convinces Laval and Cragger to go inside Mt. Cavora, because of her dream, much to their unbelief they meet Fluminox and discover the Phoenix, who have Fire CHI, the secret to the Ice Tribes' defeat, now the battle is on and the fate of an eternal Ice Age is in the 8 Heroes' hands..

Official Description This is a description taken from Do not modify it.

The LEGO Group has announced LEGO® Legends of Chima™, an original LEGO property set in a mythical land of magical animal tribes who compete for CHI, a valuable energy source which gives them extraordinary powers over one another. The story comes to life through a universe of products across the company’s entire play system including classic building sets, collectible social competition kits, buildable figures and board games, and will be fueled by digital gaming.

“Building upon our success with developing rich and immersive original storylines, most notable the recent Ninjago phenomenon, we’re excited to launch a whole new world in LEGO Legends of Chima to spark any child’s imagination and invite them to the world of LEGO building,” said Søren Torp Laursen, president of LEGO Systems, Inc. “Based on the reactions we saw through our research, there is no doubt that our immersive approach to original properties will once again inspire, engage and thrill children who love to build and play with great stories.”

Story Chima is a magical land that is ruled by tribes of highly-advanced animals who walk, talk, drive vehicles and live in castles and forts. Two of the characters were best friends, but misunderstandings challenged their friendship and they now compete for CHI, a valuable natural resource that is a powerful element and source of life. Only a few brave heroes in Chima understand the true nature of CHI and their stories, and the stories of those who seek to destroy them, are known as The Legends of Chima.

Building Sets Seven richly detailed building sets inspired by the property are available now and range in price from $14.99 to $79.99. In August, the company will introduce six constructible LEGO Chima action figures for $14.99 each and four additional building sets, ranging in price from $24.99 to $119.99.

Speedorz™: Social Competitive Play Children can challenge friends, earn CHI and increase strength and power as they go from one obstacle to the next with the new line of Chima Speedorz. Build the Chima Speedorz and various obstacle courses, then pull the new ripcord to launch them. Players earn CHI crystals from their opponents by using the enclosed game cards. Six collectible Speedorz construction sets are available now, with more slated to launch in March, June and September. Each includes a new LEGO flywheel base with ripcord, minifigure, CHI crystals, assorted LEGO pieces and a set of trump cards at a suggested price of $14.99.

Gaming To extend the story and action play to fun for the whole family, a LEGO Chima constructible board game will be available in August for $19.99.

In a related announcement, Warner Bros. Interactive Entertainment today announced three LEGO Legends of Chima videogame titles. Available now on and iOS devices is LEGO Legends of Chima™: Speedorz™,, a free-to-play racing minigame. A LEGO Legends of Chima™: Laval’s Journey will be available for the Nintendo DS™ hand-held system, the Nintendo 3DS™ hand-held system and for the PS®Vita system this summer. Additionally, LEGO Legends of Chima™ Online, a free-to-play, online immersive world game, is scheduled to launch later in the year.



Image # Set Pieces Figures Price Released
70000 alt1 70000  Razcal's Glider  109  Razcal   $11.99 / €9.99  2013 
70001 alt1 70001  Crawley's Claw Ripper  139  CrawleyLeonidas   $14.99 / €14.99  2013 
70002 alt1 70002  Lennox' Lion Attack  230  LennoxCrug   $24.99 / €19.99  2013 
70003 alt1 70003  Eris' Eagle Interceptor  348  ErisRizzoRazar   $34.99 / €32.99  2013 
70004 alt1 70004  Wakz' Pack Tracker  297  WakzWinzarEquila   $29.99 / €32.99  2013 
70005 alt1 70005  Laval's Royal Fighter  417  LavalLongtoothCrawley   $39.99 / €39.99  2013 
70006 alt1 70006  Cragger's Command Ship  609  CraggerCrominusCroolerLeonidasLennoxRawzom   $79.99 / €79.99  2013 
70007 alt1 70007  Eglor's Twin Bike  223  EglorRazcal   $24.99 / €19.99  June 2013 
70008 alt1 70008  Gorzan's Gorilla Striker  505  GorzanRizzoGrumloG'Loona   $49.99 / €49.99  June 2013 
70009 alt1 70009  Worriz's Combat Lair  664  WorrizWakzWindraWilhurtErisGrizzam   $69.99 / €69.99  June 2013 
70010 alt1 70010  The Lion CHI Temple  1258  LagravisLavalLongtoothEwaldCraggerCrawleyRazar   $119.99 / €119.99  June 2013 
70011 alt1 70011  Eagles' Castle  369  EwaldLennoxWorriz   $39.99 / €39.99  2013 
70012 alt1 70012  Razar's Chi Raider  412  RazarRizzoEwar   $39.99 / €39.99  2013 
70013 alt1 70013  Equila's Ultra Striker  339  EquilaEglorWilhurt   $39.99 / €39.99  2013 
B 70014 box side 70014  The Croc Swamp Hideout  647  CraggerCrominusCrugLeonidasLennox   $69.99 / €69.99  2013 
70100 alt1 70100  Ring of Fire  83  Razar   $14.99 / €14.99  2013 
70101 alt1 70101  Target Practice  101  Equila   $14.99 / €14.99  2013 
70102 alt1 70102  Chi Waterfall  106  Leonidas   $14.99 / €14.99  2013 
70103 alt1 70103  Boulder Bowling  93  Crominus   $14.99 / €14.99  2013 
70104 alt1 70104  Jungle Gates  81  Lennox   $14.99 / €14.99  2013 
70105 alt6 70105  Nest Jump  97  Eglor   $14.99 / €14.99  2013 
70106 alt1 70106  Ice Tower  101  Winzar   $14.99 / €14.99  2013 
70107 alt1 70107  Skunk Attack  97     $14.99 / €14.99  2013 
70108 alt1 70108  Royal Roost  105  Lagravis   $14.99 / €14.99  2013 
$T2eC16VHJHIFFhbh(VbTBRy)S1sp4w~~60 35 70109  Whirling Vines  77  Gorzan   $14.99 / €14.99  April 2013 
70110 box1 in 70110  Tower Target  92  Grizzam   $14.99 / €14.99  2013 
Lego-legends-of-chima-swamp-jump-70111 70111  Swamp Jump  91  Furty   $14.99 / €14.99  2013 
70112 box1 in 70112  Croc Chomp  105  Crug   $14.99 / €14.99  2013 
70114 alt1 70114  Sky Joust  117  RawzomEris   $20.00 / €19.99  2013 
70113 alt1 70113  CHI Battles  92  LongtoothWakz   $19.99 / €19.99  2013 
70115 alt1 70115  Ultimate Tournament  246  LavalCragger   $29.99 / €29.99  2013 
70200 alt1 70200  CHI Laval  55     $14.99 / €14.99  2013 
70201 alt1 70201  CHI Eris  67     $14.99 / €14.99  June 2013 
70202 alt1 70202  CHI Gorzan  59     $14.99 / €14.99  June 2013 
70203 alt1 70203  CHI Cragger  65     $14.99 / €14.99  June 2013 
70204 alt1 70204  CHI Worriz  55     $14.99 / €14.99  August 2013 
70205 alt1 70205  CHI Razar  68     $14.99 / €14.99  June 2013 
50006 alt1 50006  Legends of Chima  211     $19.99 / €19.99  2013 
Chima TRU titleimg Chima  Speedorz Challenge Promotional Set  45       July 27, 2013 
Lion Legend Beast 70123  Lion Legend Beast  120  Laval   $9.99  2014 
10983145143 71d5a4861b o 70124  Eagle Legend Beast  104  Eris   $9.99  2014 
10982929525 1c9fac7743 o 70125  Gorilla Legend Beast  106  Gorzan   $9.99  2014 
10982931135 5d660a0f4b o 70126  Crocodile Legend Beast  122  Cragger   $9.99  2014 
Wolf Legend Beast 70127  Wolf Legend Beast  111  Worriz   $9.99  2014 
70128box 70128  Braptor's Wing Striker  146  BraptorEris   $14.99  2014 
701293 70129  Lavertus' Twin Blade  183  LavertusScutter   $19.99  2014 
70130box 70130  Sparratus' Spider Stalker  292  SparratusGorzan   $24.99  2014 
70131box 70131  Rogon's Rock Flinger  257  RinonaRogonSparacon   $29.99  2014 
70132box 70132  Scorm's Scorpion Stinger  434  ScormLavalCragger   $39.99  2014 
Tn 70133 alt1 jpg 70133  Spinlyn's Cavern  407  SpinlynRogonEris     2014 
70134-box 70134  Lavertus' Outland Base  684  LavertusLavalBlistaSparratus   $59.99  2014 
Screen Shot 2014-06-06 at 9.53.15 AM 70135  Cragger's Fire Striker  380  CraggerStealthorVornon   $39.99  August 1, 2014 
Banana Bash 70136  Banana Bash  124  Gorzan   $14.99  2014 
Spin prod 902636612 70137  Bat Strike  101  Blista   $14.99  2014 
Web Dash 70138  Web Dash  74  Sparratus   $14.99  2014 
Sky Launch 70139  Sky Launch  111  Eris   $14.99  2014 
9200000021797588 70140  Stinger Duel  93  ScolderShadoWind   $19.99  2014 
71aeoV5dw7L. SL1040 70141  Vardy's Ice Vulture Glider  217  VardyLundor   $19.99  August 1, 2014 
61y-oubTCfL 70142  Eris' Fire Eagle Flyer  330  ErisLagravisStrainor   $29.99  August 1, 2014 
71b5iHd0cML. SL1100 70143  Sir Fangar's Saber-Tooth Walker  415  Sir FangarGorzanStealthor   $39.99  August 1, 2014 
61LS Hxd0TL 70144  Laval's Fire Lion  450  LavalCraggerMungus   $49.99  August 1, 2014 
61eUX2KOLlL 70145  Maula's Ice Mammoth Stomper  604  WorrizRazarMaulaMottrotVornonStrainor   $59.99  August 1, 2014 
61APMlFBbpL 70146  Flying Phoenix Fire Temple  1301  FluminoxFlinxFoltraxTormakLi'ellaStealthorVoomVoom   $129.99  August 1, 2014 
Screen Shot 2014-06-06 at 10.01.30 AM 70147  Sir Fangar's Ice Fortress  670  Sir FangarStrainorVoomVoomGorzanWorriz   $69.99  August 1, 2014 
LEGO NEW Chima 70149 1 70149  Scorching Blades  81  Worriz   $12.99  August 1, 2014 
914Npg 4QuL. SL1500 70150  Flaming Claws  78  Cragger   $12.99  August 1, 2014 
LEGO NEW Chima 70151 1 70151  Frozen Spikes  81  VoomVoom   $12.99  August 1, 2014 
No image 70152  Lava Breakout  59  Rogon (Rumoured)   $12.99  2014 
No image 70153  Fang Trap  79     $12.99  2014 
No image 70154  Frozen Fortress  58     $12.99  2014 
Inferno Pit 70155  Inferno Pit  78  Fluminox   $12.99  August 1, 2014 
LEGO NEW Chima 70156 1 70156  Fire vs. Ice  110  LavalSir Fangar   $19.99  August 1, 2014 
Chi Laval 70206  CHI Laval  49     $14.99  2014 
Chi Cragger 70207  CHI Cragger  58     $14.99  2014 
Chi Panthar 70208  CHI Panthar  59     $14.99  2014 
Chi Mungus 70209  CHI Mungus  64     $14.99  2014 
Chi Vardy 70210  CHI Vardy  68     $14.99  2014 
Chi Fluminox 70211  CHI Fluminox  91     $19.99  2014 
Chi Sir Fangar 70212  CHI Sir Fangar  97     $19.99  2014 

Super Pack

Image # Set Pieces Figures Price Released
66450-1 66450  Super Pack 3-in-1    RazcalCrawleyLeonidasErisRazarRizzo     2013 
66474 66474  Super Pack 2-in-1    LavalLongtoothCrawleyWorrizErisGrizzamWakzWilhurtWindra      


Image # Set Pieces Figures Price Released
30250 alt1 30250  Ewar's Acro-Fighter  33  Ewar   $4.99 RRP  January 2013 
30251-1 30251  Winzar's Pack Control  38  Winzar   $3.99  2013 
30252-1 30252  Crug's Swamp Jet  23  Crug     2013 
Dragster 30253  Leonidas' Jungle Dragster  30  Leonidas     January, 2013 
30254 Bag 30254  Razcal's Double-Crosser  36  Razcal     2013 
30255 Bag 30255  Crawley  11  Crawley     2013 
GorzanWalker 30262  Gorzan's Walker  34  Gorzan   $3.99  2014 
SpiderCrawler 30263  Spider Crawler  40  Sparratus   $3.99  2014 
30264-1 30264  Frax's Phoenix Flyer  32  Frax     2014 
30265-1 30265  Worriz' Fire Bike  31  Worriz (Fire)     2014 
30266-1 30266  Sykor's Ice Cruiser  25  Sykor     2014 
6031640-1 6031640  Chima Promotional Pack       2013 
6031641-1 6031641  Lion tribe rip-cord and topper       2013 

Key Chains

Image # Set Pieces Figures Price Released
850602-1 850602  Cragger Key Chain       2013 
850607 alt1 850607  Eris Key Chain       2013 
850608 alt1 850608  Laval Key Chain       2013 
850609 alt1 850609  Worriz Key Chain       2013 
Screen Shot 2014-04-07 at 2.12.16 PM 850908  Rogon Key Chain     $4.99  2014 
Screen Shot 2014-04-07 at 2.14.32 PM 851018  Scolder Key Chain     $4.99  2014 


Image # Set Pieces Figures Price Released
No image 850598  LEGO Legends of Chima Game Card Binder          
No image 850775  LEGO Legends of Chima Speedorz Storage Bag          
No image 850776  LEGO Legends of Chima Playmat          
No image 850899  LEGO Legends of Chima Playmat          
Screen Shot 2014-07-07 at 11.13.14 AM 850918  Ice Cube Tray       $7.99  2014 
Screen Shot 2014-07-07 at 11.12.18 AM 850919  Tumbler 2014  11     $6.99  2014 
Screen Shot 2014-07-07 at 10.58.28 AM 5002208  LEGO Legends of Chima Crawley Kid's Minifigure Watch  32  Crawley   $24.99  2013 
Screen Shot 2014-07-07 at 10.48.58 AM 5002209  LEGO Legends of Chima Lennox Kid's Minifigure Watch  32  Lennox   $24.99  2013 
Screen Shot 2014-07-07 at 11.11.56 AM 5002417  LEGO Legends of Chima Cragger Minifigure Clock       $29.99  2013 
Screen Shot 2014-07-07 at 11.12.08 AM 5002421  LEGO Legends of Chima Laval Minifigure Clock       $29.99  2013 
Screen Shot 2014-07-07 at 11.04.54 AM 5003257  Gorzan Kid's Minifigure Link Watch       $24.99  2014 
Screen Shot 2014-07-07 at 11.07.55 AM 5003258  Worriz Kid's Minifigure Link Watch       $24.99  2014 
Screen Shot 2014-07-07 at 11.15.26 AM 5003561  LEGO Legends of Chima Lunch Set       $14.99  2014 
Screen Shot 2014-07-07 at 11.14.46 AM 5003562  LEGO Legends of Chima Sorting System       $39.99  2014 


Image # Set Pieces Figures Price Released
Screen Shot 2014-07-07 at 10.37.43 AM 5002673  LEGO Legends of Chima: The Power of the CHI DVD       $14.99   
Screen Shot 2014-07-07 at 10.32.47 AM 5003578  LEGO Legends of Chima: The Lion, the Crocodile and the Power of CHI!       $19.99   


Image # Set Pieces Figures Price Released
LionsandEagles Lions  and Eagles Activity Book    Lennox     April 2013 
Screen Shot 2014-07-05 at 11.27.36 AM 5002773  LEGO Legends of Chima Brickmaster Kit: The Quest for CHI    LennoxCrawley     2013 
Screen Shot 2014-07-05 at 11.55.56 AM 5002820  LEGO Legends of Chima: Ultimate Sticker Collection       $12.99   

Role-play Weaponry

Image # Set Pieces Figures Price Released
850611 850611  Cragger's Shield     $12.99  2013 
850612 850612  Cragger Sword     $9.99  2013 
850614 850614  Laval's Shield     $12.99  2013 
850615 850615  Laval Sword     $9.99  2013 
Screen Shot 2014-03-23 at 7.35.06 PM 851015  Scorpion Sword and Shield     $17.99  2014 
851318 brickset 851318  Sir Fangar Claw & Shield     $17.99  2014 


Lion Tribe

Eagle Tribe

Gorilla Tribe

Crocodile Tribe

Raven Tribe

Wolf Tribe

Bat Tribe

Spider Tribe

Scorpion Tribe

Rhino Tribe


Vulture Tribe

Saber-Tooth Tiger Tribe

Tiger Tribe

Mammoth Tribe

Phoenix Tribe

Leopard Tribe

Other Legends of Chima Media

Video Games

Online Games

IOS Games

Android Games



  • Li'ella, Tormak, Lundor and Logas are all of different tribes, but fight for one order, The Cat Guides.
  • Instead of a regular plain Trans-Blue CHI element, the Summer 2014 sets have a Trans-Orange CHI element with Flame printing on it.


Character Teaser Videos



view · talk · edit Legends of Chima sets
Regular Sets (2013): 70000 Razcal's Glider | 70001 Crawley's Claw Ripper | 70002 Lennox' Lion Attack | 70003 Eris' Eagle Interceptor | 70004 Wakz' Pack Tracker | 70005 Laval's Royal Fighter | 70006 Cragger's Command Ship | 70007 Eglor's Twin Bike | 70008 Gorzan's Gorilla Striker | 70009 Worriz's Combat Lair | 70010 The Lion CHI Temple | 70012 Razar's CHI Raider | 70013 Equila's Ultra Striker | 70014 The Croc Swamp Hideout
Regular Sets (2014): 70128 Braptor's Wing Striker | 70129 Lavertus' Twin Blade | 70130 Sparratus' Spider Stalker | 70131 Rogon's Rock Flinger | 70132 Scorm's Scorpion Stinger | 70133 Spinlyn's Cavern | 70134 Lavertus' Outland Base | 70135 Cragger's Fire Striker | 70141 Vardy's Ice Vulture Glider | 70142 Eris Fire Eagle Flyer | 70143 Sir Fangar's Saber-Tooth Walker | 70144 Laval Fire Lion | 70145 Maula's Ice Mammoth Stomper | 70146 Flying Phoenix Fire Temple | 70147 Sir Fangar's Ice Fortress
Speedorz: 70011 Eagles' Castle | 70100 Ring of Fire | 70101 Target Practice | 70102 CHI Waterfall | 70103 Boulder Bowling | 70104 Jungle Gates | 70105 Nest Jump | 70106 Ice Tower | 70107 Skunk Attack | 70108 Royal Roost | 70109 Whirling Vines | 70110 Tower Target | 70111 Swamp Jump | 70112 Croc Chomp | 70113 CHI Battles | 70114 Sky Joust | 70115 Ultimate Speedor Tournament | 70136 Banana Bash | 70137 Bat Strike | 70138 Web Dash | 70139 Sky Launch | 70140 Stinger Duel | 70149 Scorching Blades | 70150 Flaming Claws | 70151 Frozen Spikes | 70152 Lava Breakout | 70153 Fang Trap | 70154 Frozen Fortress | 70155 Inferno Pit | 70156 Fire vs. Ice
Constraction Figures: 70200 CHI Laval | 70201 CHI Eris | 70202 CHI Gorzan | 70203 CHI Cragger | 70204 CHI Worriz | 70205 CHI Razar | 70206 CHI Laval | 70207 CHI Cragger | 70208 CHI Panthar | 70209 CHI Mungus | 70210 CHI Vardy | 70211 CHI Fluminox | 70212 CHI Sir Fangar
Legend Beasts: 70123 Lion Legend Beast | 70124 Eagle Legend Beast | 70125 Gorilla Legend Beast | 70126 Crocodile Legend Beast | 70127 Wolf Legend Beast
LEGO Games: 50006 Legends of Chima
Promotional: 30250 Ewar's Acro-Fighter | 30251 Winzar's Pack Patrol |
Video Games: LEGO Legends of Chima: Laval’s Journey | LEGO Legends of Chima Online | Legends of Chima: Speedorz
Other: LEGO Legends of Chima: The Secret History | Chima Speedorz Challenge Promotional Set | 66450 Super Pack 3-in-1 | 850611 Cragger's Shield | 850612 Cragger Sword | 850614 Laval's Shield | 850615 Laval Sword | 6031640 Chima Promotional Pack | 6031641 Lion tribe rip-cord and topper | Lions and Eagles Activity Book | TBA Legends of Chima Brickmaster | Attack of the Crocodiles
view · talk · edit Legends of Chima Minifigures
Lion Tribe: Laval | Lennox | Leonidas | Longtooth | Lagravis | Lothar | Lavertus | ShadoWind | Lion Soldiers | Lion Elders | Li'ella
Eagle Tribe: Eglor | Equila | Eris | Ewar | Ewald | Elida | Reegull | Eagle Soldiers | Elkar
Gorilla Tribe: Gorzan | Grizzam | G'Loona | Grumlo | Gelsi | Gompsy | Gorilla Soldiers
Raven Tribe: Razar | Rawzom | Razcal | Rizzo | Reabait | Reegull | Ripnik
Wolf Tribe: Wakz | Wilhurt | Winzar | Worriz | Windra | Wonald | Wolf Soldiers
Crocodile Tribe: Cragger | Crawley | Crug | Crominus | Crooler | Cruz | Crunket | Cranvil | Crocodile Soldiers
Rhino Tribe: Rhigor | Rogon | Rinona | Rukus | Runk
Bear Tribe: Balkar | Bladvic | Bumpy | Bungey | Bozy | Buchuma
Beaver Tribe: Bezar | Buber | Bunic | Beavers
Bat Tribe: Blista | Braptor | Bat Soldiers
Scorpion Tribe: Scolder | Scutter | Scorm | Scorpion Soldiers
Spider Tribe: Sparacon | Sparratus | Spinlyn | Spider Soldiers
Saber-Tooth Tiger Tribe: Sir Fangar | Strainor | Stealthor | Sykor | Saber-Tooth Tiger Soldiers
Mammoth Tribe: Maula | Mungus | Mottrot | Mammoth Soldiers
Vulture Tribe: Vardy | VoomVoom | Vornon | Vulture Soldiers
Phoenix Tribe: Fluminox | Flinx | Foltrax | Frax | Firox
Leopard Tribe: Lundor | Logas
Tiger Tribe: Tormak
Nomads: Dom de la Woosh | Furty | Skinnet
Legend Beasts: Bear Legend | Crocodile Legend | Eagle Legend | Gorilla Legend | Lion Legend | Raven Legend | Rhinoceros Legend | Wolf Legend

Start a Discussion Discussions about Legends of Chima

Around Wikia's network

Random Wiki